Everything below concerns Dietary supplement. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-06-27. Numbers and descriptions here follow the published literature rather than marketing material.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide base with a ribose sugar and a phosphate group. Within cells, NMN sits on the biosynthetic route that recycles nicotinamide back into nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in redox reactions and signaling, enzymes that produce and consume it influence many metabolic processes. The compound is therefore best described as an intermediate rather than a final signaling molecule.
In the canonical salvage pathway, nicotinamide phosphoribosyltransferase, known as NAMPT, transfers a phosphoribosyl group to nicotinamide and releases NMN. A second enzyme, NMN adenylyltransferase, then attaches an adenylyl group to NMN to form NAD+. Alternative routes exist, including a pathway that uses nicotinamide riboside and its phosphorylated forms. The relative contribution of extracellular NMN to intracellular NAD+ pools remains an area of active investigation, and the roles of specific transporters and enzymes are not completely defined.
NMN is present in small amounts in various foods, including certain vegetables, fruits, and milk, though dietary quantities are generally low. Laboratory research often uses synthetic or enzymatically produced NMN. The compound has drawn interest because NAD+ levels decline with age in some tissues and because restoring NAD+ may affect metabolism in animal models. Whether oral NMN produces meaningful NAD+ increases in humans and whether such changes translate into health benefits are not fully established.
Analytical measurement of NMN typically uses high-performance liquid chromatography with ultraviolet detection, often at a wavelength near 260 nanometers. Liquid chromatography coupled with tandem mass spectrometry provides greater sensitivity and specificity, especially for biological samples. Nuclear magnetic resonance spectroscopy can confirm structure and detect certain impurities. Purity values reported by suppliers depend on the analytical method, calibration standards, and whether related compounds such as nicotinamide or NAD+ are included in the calculation. Independent verification is useful because supplement labels may not fully describe the tested material.
Regulatory treatment of NMN differs by country and has changed over time. In the United States, the Food and Drug Administration has stated that NMN is excluded from the definition of a dietary supplement because it was investigated as a drug before being marketed as a supplement; enforcement and legal interpretation continue to evolve. In the European Union, NMN may require authorization as a novel food before sale. In Japan, NMN has been marketed in some food products, while it is not approved as a therapeutic drug in major markets. These categories affect labeling, permitted claims, and quality oversight.
Solid NMN is generally handled as a moisture-sensitive and light-sensitive material. Suppliers commonly recommend storage at minus 20 degrees Celsius in a sealed, desiccated container, protected from light. Aqueous solutions are less stable than the solid and may degrade faster at elevated temperatures or extreme pH values. Because NMN contains a phosphate ester and a glycosidic bond, hydrolysis and other degradation pathways are plausible under unfavorable conditions. Stability data from independent laboratories remain limited, so handling recommendations often reflect supplier practice rather than published consensus.
| Property | Value | Notes |
|---|---|---|
| Chemical name | Nicotinamide mononucleotide | Abbreviated NMN |
| Molecular formula | C11H15N2O8P | Neutral form |
| Molar mass | 334.22 g/mol | Approximate value |
| Appearance | White to off-white powder | Typical solid form |
| Solubility | Water-soluble | May absorb moisture |
NMN occurs in many living systems, including bacteria, yeast, plants, and mammals. Dietary sources are present in foods such as edamame, avocado, broccoli, and various meats, but amounts vary widely and are generally lower than those used in research settings. Laboratory production often relies on enzymatic synthesis or chemical phosphorylation of nicotinamide riboside, and commercial material is typically supplied as a white to off-white powder. Because NMN is hygroscopic and sensitive to heat, moisture, and pH extremes, its handling requires care to preserve identity and purity. Aqueous preparation should be done with attention to pH and temperature to limit hydrolysis.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure consists of a nicotinamide ring linked to ribose phosphate, and the compound serves as an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+. In this pathway, nicotinamide phosphoribosyltransferase converts nicotinamide and phosphoribosyl pyrophosphate into NMN, after which NMN adenylyltransferase attaches an adenylate group to produce NAD+. Because NAD+ participates in redox reactions and signaling, NMN occupies a central position in cellular metabolism. The molecule is distinct from nicotinamide riboside, though the two are related in NAD+ precursor research.
Beyond its intracellular synthesis, NMN can be taken up from the extracellular environment, although the routes are still debated. Some evidence points to direct transport into cells through specific transporters, while other work suggests dephosphorylation to nicotinamide riboside followed by cellular uptake. Once inside, NMN can be converted to NAD+ by NMN adenylyltransferases; the relative contribution of these routes may differ by tissue, species, and experimental conditions. Researchers continue to investigate which mechanisms dominate in intact organisms and how they affect measured NAD+ levels. Direct measurement in tissues remains technically challenging because NMN can be rapidly metabolized during sample collection.
Quality control for NMN samples often includes purity determination by HPLC, identity confirmation by mass spectrometry or NMR, and water content measurement by Karl Fischer titration. Certificates of analysis may report residual solvents, heavy metals, and microbial limits depending on the intended use. Purity values are method-dependent, so a stated percentage should be interpreted alongside the analytical procedure and detection wavelength. Reference standards help ensure that retention times and spectral data are comparable across laboratories. Researchers increasingly request independent verification because supply chains for specialty chemicals can vary in documentation.
Common laboratory methods for NMN include high-performance liquid chromatography with ultraviolet detection, liquid chromatography coupled to mass spectrometry, and nuclear magnetic resonance spectroscopy. Because the nicotinamide ring absorbs ultraviolet light, HPLC-UV at wavelengths near 260 nm can be used for purity assessment. LC-MS and LC-MS/MS provide greater sensitivity and are often applied to biological samples. Identification typically relies on matching retention time, mass-to-charge ratio, and fragmentation pattern to a reference standard.
Extracting oil (or "bitumen") from oil/tar sand and oil shale deposits requires mining the sand or shale and heating it in a vessel or retort, or using "in-situ" methods of injecting heated liquids into the deposit and then pumping the liquid back out saturated with oil.
Diplomatic Service and Overseas List Bathsheba Abse, Curator, Keats–Shelley Memorial House, Rome. Duncan Bnerton Allan, Second Secretary, British Embassy, Moscow. Jean Armstrong del Bianco. For services to British cultural interests in Venice. Au Chi-lau, . For services to civil engineering in Hong Kong. Christopher Rodney Baker, Honorary Consul, Dunkirk. Sigrid Geraldine Wells Barnes. For charitable services in the Falkland Islands. Janet Bershers, British Vice-Consul, Chicago. Kenneth Geoffrey Birch, British Vice-Consul, Zurich. John Basil Boursot. For services to zoology in El Salvador. Chan Kim-to. For public service, Hong Kong. Chan Kong-sang. For public service, Hong Kong. Peter Chau Cham-chiu, , Assistant Commissioner (Auxiliary), Royal Hong Kong Police Force. Maureen Anne Chesterton, British Vice-Consul, Lima. Michael Chik Wah-wai, Assistant Commissioner, Customs and Excise, Hong Kong. Mary Matilda Cooper, . For services to nursing and welfare, Montserrat. Nicola Jane Crews. For services to disabled people, Indonesia. Brendan William Laurence Egan. For services to the British School, Manila. Margaret Elsworth. For services to education and health, South Africa. John Barrymore Eustice. For services to disabled people, Botswana. The Reverend Father Anthony Fleming. For charitable and welfare services to the community in Orissa, India. Frank Charles Gamble, Director, British Red Cross Society, Bermuda. Christopher Garratt. For services to the British community in Brussels. Martin Fraser Gibson. For services to the British community in Uruguay.
=== Civil rights === Bhutto Zardari has repeatedly defended the rights of minorities in Pakistan. On 4 December 2012, in a statement responding to reports about the demolition of a Hindu temple in Karachi and a desecration of an Ahmadiyya graveyard in Lahore he said, "Our forefathers did not sacrifice their lives for an intolerant, extremist, sectarian, and authoritarian Pakistan. I appeal to all of you to rise up and defend Jinnah's Pakistan. My party and I will stand by you, shoulder to shoulder." During a cake cutting ceremony for Christmas in Karachi, on 25 December 2018, Bhutto Zardari said that he PPP is the custodian of social justice, parity, religious, and interfaith harmony in the country and its advocacy for the prevalence of peace and tranquility across the world is heavily established. At the memorial for the 7th death anniversary of former Federal Minister of Interfaith Harmony, Shahbaz Bhatti on 3 March 2018, Bhutto Zardari said, "May I take this opportunity to say that we share the concerns over the misuse of blasphemy laws. This is the concern of not only the Christian community but of all of us. It is my concern too. These laws have been used as a tool by extremists to settle personal scores. They have been used to grab the properties of Christians and other non-Muslims. The blasphemy laws carry the mandatory death penalty. We must prevent their misuse. We will." On 29 September 2019, he visited the Hindus in Ghotki and the Sacho Satram Dham temple which was desecrated in the 2019 Ghotki riots and condemned the attack.
December 28, 1967: Authorization of contraception by the Neuwirth Law; however, its implementation decrees would not be published until 1971. January 24, 1968: Decree on common provisions applicable to civil servants in the active services of the national police: unless an exception is made, a woman cannot be appointed to a position within the active services. May 24, 1969: Decree setting the amount of the single salary allowance and the stay-at-home mother's allowance. June 4, 1970: In the Civil Code, "joint parental authority" replaces "paternal authority," and "both spouses jointly ensure the moral and material guidance of the family." July 15, 1970: Law concerning the École Polytechnique, which notably allows women to take the entrance exam and sets the conditions for their employment after graduation. August 26, 1970: Founding of the Women's Liberation Movement (MLF), marked by the laying of a wreath "to the wife of the unknown soldier" on the Tomb of the Unknown Soldier beneath the Arc de Triomphe in Paris. December 23, 1970: Decree increasing the rate of daily rest allowances for maternity insurance under the general social security system. April 5, 1971: Publication of the "Manifesto of the 343" in Le Nouvel Observateur: signed by 343 women — including celebrities — declaring they had undergone an abortion and demanding the right to free abortion. April 16, 1971: Ministerial order regarding the Women's Work Committee, replacing the Study and Liaison Committee on Women's Work Issues. June 10, 1971: Law on parentage.
Sources: en.wikipedia.org
The influence of the art of Gandhara in some of the paintings at the Kizil Caves, dated to circa 500 CE, is considered as a consequence of the political unification of the area between Bactria and Kucha under the Hephthalites. The paintings of the Caves of the Painters have been carbon dated to 478–536 CE. Albert Grünwedel in 1912 considered that the murals of the "Cave of the Statues" had been "made by the same artists as those of the Cave of the Painters", and that they were in "pure Gandhara style". Also, a self-portraited painter in the Caves of the Statues, holding a cup of paint, has clothes which "exactly match" those of the painters in the "Cave of the Painters" (caftan, boots...). The clothing style of the painters at Kizil has often been described as Sasanian, but is now rather considered as Hephthalite due to the similarities with the figures in Bamiyan, Dilberjin Tepe or Balalyk Tepe. Grünwedel attributed both caves to the same "Stage I" period (500–600 CE). The main cella contains 18 scenes of the Buddha preaching. The niche must have contained a monumental statue of the Buddha, and paintings related to the Indrasala Cave narrative. The ceiling is prismatic, reproducing a type of architecture known from Bamiyan. The right corridor contained murals related to the War for the Relics and the Sharing of the relics of the Buddha, one of them showing armoured warriors on horses. The murals of the back corridor were almost entirely gone by 1912. Only a few traces remained, suggesting scenes of the Parinirvana.
Several obstacles have been encountered in the development of astatine-based radiopharmaceuticals for cancer treatment. World War II delayed research for close to a decade. Results of early experiments indicated that a cancer-selective carrier would need to be developed and it was not until the 1970s that monoclonal antibodies became available for this purpose. Unlike iodine, astatine shows a tendency to dehalogenate from molecular carriers such as these, particularly at sp3 carbon sites (less so from sp2 sites). Given the toxicity of astatine accumulated and retained in the body, this emphasized the need to ensure it remained attached to its host molecule. While astatine carriers that are slowly metabolized can be assessed for their efficacy, more rapidly metabolized carriers remain a significant obstacle to the evaluation of astatine in nuclear medicine. Mitigating the effects of astatine-induced radiolysis of labeling chemistry and carrier molecules is another area requiring further development. A practical application for astatine as a cancer treatment would potentially be suitable for a "staggering" number of patients; production of astatine in the quantities that would be required remains an issue. Animal studies show that astatine, similarly to iodine—although to a lesser extent, perhaps because of its slightly more metallic nature—is preferentially (and dangerously) concentrated in the thyroid gland. Unlike iodine, astatine also shows a tendency to be taken up by the lungs and spleen, possibly because of in-body oxidation of At− to At+.
However, because CPE is not a rate-limiting enzyme for the production of most neuropeptides and peptide hormones, it is not clear how relatively modest decreases in CPE activity can cause physiological effects.
He was elected a Foreign Member of the Royal Society (1957). His honorary memberships of foreign academies and scientific societies included: the Romanian Physical Society in Bucharest, the Royal Spanish Society for Chemistry and Physics and the Spanish National Research Council, and the Academies in Allahabad, Bangalore, Berlin, Boston, Bucharest, Copenhagen, Göttingen, Halle, Helsinki, Lisbon, Madrid, Mainz, Munich, Rome, Stockholm, the Vatican, and Vienna. He was an honorary fellow of University College London,
The benefits of beak trimming are mainly welfare advantages for birds kept in close confinement, some of which directly relate to increases (or reduced decreases) in production. These include reduced feather pecking and cannibalism, better feathering (though they find it hard to preen with shortened beaks, which means they are not cleaning themselves well), less fearfulness and nervousness, less chronic stress, and decreased mortality.
Sources: en.wikipedia.org
== Reception == Since its broadcast, the series has caused heated discussions online and obtained high ratings. Shen Yan, director of the series, attribute the show's success to its capability to capture modern life in China through several ordinary people's lives and the great influence of book writer Isabel Nee Yeh-su. By emphasizing the importance of female independence, the series has won much favor among female audiences. However, the series has been criticized by book fans for veering too much from the plot. Its display of improper ethical values has also been criticized for degrading social conduct.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to IFN, this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (IRF9) and form ISGF-3 (IFN-stimulated gene factor-3), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. The protein mediates innate antiviral activity. Mutations in this gene result in Immunodeficiency 44. ISGF-3 proceeds the activation of genes via the IFN-stimulated response element (ISRE). ISRE-driven genes include Ly-6C, the double-stranded RNA kinase (PKR), 2´ to 5´ oligoadenylate synthase (OAS), MX and potentially MHC class I. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. STAT2 knockout mice are unresponsive to type I IFN and extremely vulnerable to viral infection. They indicate the loss of the type I IFN autocrine loop and several defects in macrophages and T cell responses. Stat2-/- cells show differences in the biological response to IFN-α.
The Pearl Index, also called the Pearl rate, is the most common technique used in clinical trials for reporting the effectiveness of a birth control method. It is a very approximate measure of the number of unintended pregnancies in 100 woman-years of exposure that is simple to calculate, but has a number of methodological deficiencies. The index was introduced by Raymond Pearl in 1934. It has remained popular for over eighty years, in large part because of the simplicity of the calculation. Several kinds of information are needed to calculate a Pearl Index for a particular study: the total number of months or cycles of exposure by women in the study the number of pregnancies the reason for leaving the study (pregnancy or other reason) There are two calculation methods for determining the Pearl Index:
There is only one viral toxin that has been described so far: NSP4 from rotavirus. It inhibits the microtubule-mediated secretory pathway and alters cytoskeleton organization in polarized epithelial cells. It has been identified as the viral enterotoxin based on the observation that the protein caused diarrhea when administered intraperitoneally or intra-ileally in infant mice in an age-dependent manner. NSP4 can induce aqueous secretion in the gastrointestinal tract of neonatal mice through activation of an age- and Ca2+-dependent plasma membrane anion permeability.
Sources: en.wikipedia.org
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ biosynthesis. It occurs naturally in cells and is also produced commercially as a supplement ingredient.
No. NMN is a precursor that can be converted into NAD+, while NAD+ is a dinucleotide coenzyme involved in redox reactions and signaling.
Small amounts have been reported in foods such as edamame, avocado, broccoli, and milk. Dietary amounts are generally much lower than those used in research studies.
Solid NMN is commonly stored frozen at about minus 20 degrees Celsius, sealed against moisture, and protected from light. Solutions are typically prepared fresh because they can degrade more quickly. Specific storage conditions can vary by supplier and intended use.