This is a working overview of nicotinamide mononucleotide, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-08-30 and is reviewed periodically as new material appears.
Research interest in NMN increased after animal studies reported that oral or injected NMN can raise NAD+ levels in some tissues. How NMN is absorbed and distributed in humans is not fully established. Some evidence suggests extracellular NMN may be dephosphorylated to nicotinamide riboside before cellular uptake, while other studies propose specific transport routes. Direct human data on these mechanisms remain limited. Regulatory status also varies: in some countries NMN is treated as a dietary supplement, while elsewhere it is restricted or requires approval, and these differences affect labeling, sale, and research.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide found in the cells of many organisms. Its structure consists of a nicotinamide group linked to a ribose sugar that carries a phosphate group. NMN is an intermediate in the biosynthesis of nicotinamide adenine dinucleotide, or NAD+, a coenzyme involved in many metabolic reactions. The abbreviation usually refers to the beta anomer, though related forms can exist. In scientific literature, NMN is distinct from nicotinamide riboside, another NAD+ precursor.
In the NAD+ salvage pathway, the enzyme NAMPT converts nicotinamide and a phosphate-donor molecule into NMN. A second enzyme, NMNAT, then converts NMN into NAD+. Nicotinamide riboside can also enter this route after being converted to NMN by nicotinamide riboside kinases. Because NMN sits at a junction between precursor uptake and NAD+ formation, its cellular concentration is tightly linked to enzyme activity and tissue type. NAD+ participates in redox reactions, signaling, and DNA repair, and its levels decline with age in some animal models, though human evidence remains more limited and context-dependent.
Research on NMN has focused on aging, metabolic regulation, exercise capacity, and insulin sensitivity, but findings are preliminary. Many human trials are small, short in duration, and use different endpoints, which complicates comparison across studies. No national regulator has approved NMN as a therapeutic drug for any indication. In some countries it is sold as a supplement or research chemical, while other jurisdictions have questioned its status under food or supplement laws. Claims about extending human lifespan or reversing aging are not supported by established clinical evidence.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in the cells of many organisms, including bacteria, plants, and mammals. Its structure consists of a nicotinamide ring attached to a ribose-phosphate group. NMN functions as an intermediate in the NAD+ salvage pathway, a recycling route that regenerates nicotinamide adenine dinucleotide. The enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. A second enzyme, NMN adenylyltransferase, then converts NMN into NAD+.
| Property | Value | Notes |
|---|---|---|
| Chemical name | Nicotinamide mononucleotide | Common name; beta form often denoted beta-NMN |
| Chemical formula | C11H15N2O8P | As free acid; salt forms differ |
| Molar mass | 334.22 g/mol | Calculated for the free acid |
| CAS Registry Number | 1094-61-7 | For beta-nicotinamide mononucleotide |
| Biochemical role | NAD+ intermediate | Participates in the salvage biosynthesis pathway |
In the salvage pathway, NMN is generated from nicotinamide and 5-phosphoribosyl-1-pyrophosphate by the enzyme nicotinamide phosphoribosyltransferase. A second route produces NMN from nicotinamide riboside through phosphorylation by nicotinamide riboside kinases. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferases, often called NMNAT enzymes. This stepwise route allows cells to recycle nicotinamide and maintain NAD+ levels under changing metabolic conditions. The relative contribution of each route varies by tissue, species, and physiological state, and it remains an active area of research.
Research on NMN has expanded because NAD+ concentrations decline with age in some tissues and because NAD+ participates in energy metabolism, DNA repair, and signaling. Animal studies have reported changes in NAD+ levels after NMN administration, but human data are more limited and often focus on safety, pharmacokinetics, and biomarker changes. Questions remain about oral absorption, tissue distribution, and whether changes in blood NAD+ reflect changes inside specific organs. NMN is not an approved drug, and claims about its clinical effects should be distinguished from established biochemical findings.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. The compound exists in cells as an intermediate in the production of nicotinamide adenine dinucleotide, a central redox cofactor. NMN is distinct from nicotinamide riboside, another related pyridine nucleotide, although the two compounds can converge in metabolic pathways. Its chemical formula is C11H15N2O8P, and it carries a net negative charge at physiological pH.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure consists of a nicotinamide ring linked to ribose phosphate, and the compound serves as an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+. In this pathway, nicotinamide phosphoribosyltransferase converts nicotinamide and phosphoribosyl pyrophosphate into NMN, after which NMN adenylyltransferase attaches an adenylate group to produce NAD+. Because NAD+ participates in redox reactions and signaling, NMN occupies a central position in cellular metabolism. The molecule is distinct from nicotinamide riboside, though the two are related in NAD+ precursor research.
Beyond its intracellular synthesis, NMN can be taken up from the extracellular environment, although the routes are still debated. Some evidence points to direct transport into cells through specific transporters, while other work suggests dephosphorylation to nicotinamide riboside followed by cellular uptake. Once inside, NMN can be converted to NAD+ by NMN adenylyltransferases; the relative contribution of these routes may differ by tissue, species, and experimental conditions. Researchers continue to investigate which mechanisms dominate in intact organisms and how they affect measured NAD+ levels. Direct measurement in tissues remains technically challenging because NMN can be rapidly metabolized during sample collection.
Chris Webb wins the 2024 Blackpool South by-election, with a 26% swing to Labour. Research carried out by the University of Leicester suggests squirrels may have passed leprosy on to mediaeval humans in the UK. 4 May 2024 London mayoral election: Labour's Sadiq Khan secures a third term as Mayor of London with 44% of the vote, beating the Conservative Susan Hall on 33%. 2024 West Midlands mayoral election: Labour's Richard Parker narrowly defeats the Conservative incumbent Andy Street to become Mayor of the West Midlands. 2024 Greater Manchester mayoral election: Labour's Andy Burnham secures a third term as Mayor of Greater Manchester with almost two-thirds of the votes cast. 5 May – With all votes counted, the results from the local elections in England are: Labour 1,158 (+186), Liberal Democrat 522 (+104), Conservative 515 (−474), Independents and others 228 (+93), Green 181 (+74), Residents' Association 48 (+11), Workers Party of Britain 4 (+4), Reform UK 2 (+2). 6 May King Charles III, celebrates the first anniversary of his coronation. The NHS will roll out laser interstitial thermal therapy (known as LITT) next month in England to help reduce seizures for patients with epilepsy that cannot be controlled by standard anti-seizure drugs. John Swinney is confirmed as Leader of the Scottish National Party after being unopposed in the leadership election, and begins his second tenure in the post. Heineken announces plans to reopen UK pubs that were previously closed and to invest £39m in refurbishments.
== Structural studies == As of late 2007, 8 structures have been solved for this class of enzymes, with PDB accession codes PDB: 1A0G, PDB: 1DAA, PDB: 1G2W, PDB: 2DAA, PDB: 2DAB, PDB: 3DAA, PDB: 4DAA, and PDB: 5DAA.
== Origin == The Y chromosome follows patrilineal inheritance, meaning it is only passed on among males, from father to son. Mitochondrial DNA on the other hand follows matrilineal inheritance, meaning it is only passed on from the mother to her children and from her daughters to their children. In 1997 Laurent Excoffier, his student Estella Poloni and his team reported that they had found a strong correlation between the Y-chromosomal sequence P49a,f/Taql variation and linguistics, while not being able to find such a correspondence for the mtDNA variation. Poloni et al. proposed the possible consequences of such a correlation, i.e. the Father Tongue hypothesis:
== Diagnosis == A genetic test is available for Type 1 PSSM. This test requires a blood or hair sample, and is less-invasive than muscle biopsy. However, it may be less useful for breeds that are more commonly affected by Type 2 PSSM, such as light horse breeds. Often a muscle biopsy is recommended for horses displaying clinical signs of PSSM but who have negative results for GSY1 mutation. A muscle biopsy may be taken from the semimembranosis or semitendinosis (hamstring) muscles. The biopsy is stained for glycogen, and the intensity of stain uptake in the muscle, as well as the presence of any inclusions, helps to determine the diagnosis of PSSM. This test is the only method for diagnosing Type 2 PSSM. Horses with Type 1 PSSM will usually have between 1.5 and 2 times the normal levels of glycogen in their skeletal muscle. While abnormalities indicating muscle damage can be seen on histologic sections of muscle as young as 1 month of age, abnormal polysaccharide accumulation may take up to 3 years to develop.
The Court of Justice, repeating its view in Van Gend en Loos, said member states "have limited their sovereign rights, albeit within limited fields, and have thus created a body of law which binds both their nationals and themselves" on the "basis of reciprocity". EU law would not "be overridden by domestic legal provisions, however framed... without the legal basis of the community itself being called into question". This meant any "subsequent unilateral act" of the member state inapplicable. Similarly, in Amministrazione delle Finanze dello Stato v Simmenthal SpA, a company, Simmenthal SpA, claimed that a public health inspection fee under an Italian law of 1970 for importing beef from France to Italy was contrary to two Regulations from 1964 and 1968. In "accordance with the principle of the precedence of Community law", said the Court of Justice, the "directly applicable measures of the institutions" (such as the Regulations in the case) "render automatically inapplicable any conflicting provision of current national law". This was necessary to prevent a "corresponding denial" of Treaty "obligations undertaken unconditionally and irrevocably by member states", that could "imperil the very foundations of the" EU. But despite the views of the Court of Justice, the national courts of member states have not accepted the same analysis.
Sources: en.wikipedia.org
Cytochromes c (cyt c, c-type cytochromes) cytochromes, or heme-containing proteins, that have heme C covalently attached to the peptide backbone via one or two thioether bonds. These bonds are in most cases part of a specific Cys-X-X-Cys-His (CXXCH) binding motif, where X denotes a miscellaneous amino acid. Two thioether bonds of cysteine residues bind to the vinyl sidechains of heme, and the histidine residue coordinates one axial binding site of the heme iron. Less common binding motifs can include a single thioether linkage, a lysine or a methionine instead of the axial histidine or a CXnCH binding motif with n>2. The second axial site of the iron can be coordinated by amino acids of the protein, substrate molecules or water. Cytochromes c possess a wide range of properties and function as electron transfer proteins or catalyse chemical reactions involving redox processes. A prominent member of this family is mitochondrial cytochrome c.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
The World Bektashi Congress, also called the National Congress of the Bektashi, a conference during which members of the Bektashi Community make important decisions, has been held in Albania several times. Since 1945, it has been held exclusively in Tirana. The longest gap between two congresses lasted from 1950 to 1993, when congresses could not be held during Communist rule in Albania. A list of congresses is given below.
April 12: Decree stating no woman accused of a capital crime can be tried until verified she is not pregnant, with provisions for verification, temporary reprieves, or penalty adjustments. May 23: Decree barring women from political assemblies and gatherings of more than five. October 25: Bonuses for certain requisitioned port workers during wartime are paid directly to wives. 1798
Sources: en.wikipedia.org
Nicotinamide mononucleotide is a nucleotide intermediate in the biosynthesis of NAD+. It consists of nicotinamide attached to a ribose phosphate unit. NMN occurs naturally in cells and is present at low levels in some foods.
NMN is a direct precursor in the NAD+ salvage pathway. Enzymes called NMNAT convert NMN into NAD+, a coenzyme used in metabolism and cell signaling. Raising NMN may increase NAD+ in some experimental settings, but the effect depends on tissue and organism.
No. Nicotinamide riboside is a related compound that lacks the phosphate group present in NMN. Cells can convert nicotinamide riboside into NMN, and both compounds feed into NAD+ production through overlapping routes.
NMN is nicotinamide mononucleotide, a nucleotide intermediate in the NAD+ salvage pathway. Cells use it to help regenerate NAD+, a coenzyme involved in energy metabolism and cellular signaling. It is present naturally in many organisms and is also produced synthetically for research and consumer products.